PDB entry 2bzs

View 2bzs on RCSB PDB site
Description: binding of anti-cancer prodrug cb1954 to the activating enzyme nqo2 revealed by the crystal structure of their complex.
Class: oxidoreductase
Keywords: oxidoreductase, nqo2, cb1954, fad, flavoprotein, metal-binding, polymorphism, zinc
Deposited on 2005-08-22, released 2005-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nrh dehydrogenase [quinone] 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BZS
    • Uniprot P16083 (6-235)
    Domains in SCOPe 2.07: d2bzsa_
  • Chain 'B':
    Compound: nrh dehydrogenase [quinone] 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BZS
    • Uniprot P16083 (6-235)
    Domains in SCOPe 2.07: d2bzsb_
  • Heterogens: ZN, FAD, CB1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bzsA (A:)
    chainaagkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkd
    itgtlsnpevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkg
    wmdrvlcqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhg
    tlhfcgfkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bzsA (A:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bzsB (B:)
    chainaagkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkd
    itgtlsnpevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkg
    wmdrvlcqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhg
    tlhfcgfkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bzsB (B:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq