PDB entry 2bzp

View 2bzp on RCSB PDB site
Description: senp1 structure
Class: hydrolase
Keywords: protease, hydrolase, nuclear protein, thiol protease, ubl conjugation pathway
Deposited on 2005-08-19, released 2005-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2005-09-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.22
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sentrin-specific protease 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (184-225)
    • PDB 2BZP (183-183)
    Domains in SCOPe 2.06: d2bzpa_
  • Chain 'B':
    Compound: sentrin-specific protease 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (184-225)
    • PDB 2BZP (183-183)
    Domains in SCOPe 2.06: d2bzpb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bzpA (A:)
    efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
    merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
    vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqipqqmn
    gsddcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bzpB (B:)
    efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
    merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
    vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqipqqmn
    gsddcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll