PDB entry 2bzg

View 2bzg on RCSB PDB site
Description: crystal structure of thiopurine s-methyltransferase.
Class: transferase
Keywords: methyltransferase, polymorphism, transferase, psi, protein structure initiative, structural genomics consortium (sgc)
Deposited on 2005-08-17, released 2005-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.214
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiopurine s-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BZG
    • Uniprot P51580 (Start-231)
    Domains in SCOPe 2.07: d2bzga1
  • Heterogens: SAH, B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bzgA (A:)
    gstevqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgka
    vemkwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislycc
    sifdlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhp
    gppfyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bzgA (A:)
    evqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgkavem
    kwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislyccsif
    dlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhpgpp
    fyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek