PDB entry 2bzf

View 2bzf on RCSB PDB site
Description: structural basis for DNA bridging by barrier-to-autointegration factor (baf)
Class: DNA-binding protein
Keywords: DNA-binding protein, retroviral integration, non-specific DNA-binding, DNA compaction, nuclear organization, lem family
Deposited on 2005-08-16, released 2005-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.244
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barrier-to-autointegration factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2bzfa_
  • Chain 'B':
    Compound: 5'-d(*gp*tp*gp*gp*ap*gp*gp)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*cp*tp*cp*cp*ap*cp)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bzfA (A:)
    mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
    ewlkdtcganakqsrdcfgclrewcdafl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bzfA (A:)
    ttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfre
    wlkdtcganakqsrdcfgclrewcdafl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.