PDB entry 2bze

View 2bze on RCSB PDB site
Description: nmr structure of human rtf1 plus3 domain.
Class: transcription regulation
Keywords: human rtf1 plus3 domain, transcription, elongation, paf1 complex, histone h3 methylation, h2b ubiquitination, cdc73, leo1, ctr9, plus3 domain, transcription regulation, structural proteomics in europe, spine, structural genomics
Deposited on 2005-08-16, released 2007-01-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kiaa0252 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BZE (0-20)
    • Uniprot Q92541 (21-152)
    Domains in SCOPe 2.05: d2bzea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bzeA (A:)
    mgsshhhhhhssglvprgshmvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigi
    gnhnskpvyrvaeitgvvetakvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftese
    fmkwkeamfsagmqlptldeinkkelsikealn