PDB entry 2bzd

View 2bzd on RCSB PDB site
Description: galactose recognition by the carbohydrate-binding module of a bacterial sialidase.
Class: hydrolase
Keywords: sialidase, hydrolase, carbohydrate binding module, glycosidase
Deposited on 2005-08-16, released 2005-08-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterial sialidase
    Species: MICROMONOSPORA VIRIDIFACIENS [TaxId:1881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (0-600)
      • engineered mutation (213)
    Domains in SCOPe 2.05: d2bzda1, d2bzda2, d2bzda3
  • Chain 'B':
    Compound: bacterial sialidase
    Species: MICROMONOSPORA VIRIDIFACIENS [TaxId:1881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (0-600)
      • engineered mutation (213)
    Domains in SCOPe 2.05: d2bzdb1, d2bzdb2, d2bzdb3
  • Chain 'C':
    Compound: bacterial sialidase
    Species: MICROMONOSPORA VIRIDIFACIENS [TaxId:1881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02834 (Start-600)
      • engineered mutation (213)
    Domains in SCOPe 2.05: d2bzdc1, d2bzdc2, d2bzdc3
  • Heterogens: NA, GAL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bzdA (A:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bzdB (B:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bzdC (C:)
    geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstd
    ggrtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpad
    pnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyt
    iinaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkv
    avstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgt
    irmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggica
    pftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgq
    vtitvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgra
    snvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiy
    tslngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegq
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bzdC (C:)
    eplyteqdlavngregfpnyripaltvtpdgdllasydgrptgidapgpnsilqrrstdg
    grtwgeqqvvsagqttapikgfsdpsylvdretgtifnfhvysqrqgfagsrpgtdpadp
    nvlhanvatstdggltwshrtitaditpdpgwrsrfaasgegiqlrygphagrliqqyti
    inaagafqavsvysddhgrtwrageavgvgmdanktvelsdgrvllnsrdsarsgyrkva
    vstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgti
    rmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlggicap
    ftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqakgqv
    titvpagttpgryrvgatlrtsagnasttftvtvglldqarmsiadvdseetaredgras
    nvidgnpstfwhtewsradapgyphrisldlggthtisglqytrrqnsaneqvadyeiyt
    slngttwdgpvasgrfttslapqravfpardaryirlvalseqtghkyaavaelevegqr