PDB entry 2bzb

View 2bzb on RCSB PDB site
Description: NMR Solution Structure of a protein aspartic acid phosphate phosphatase from Bacillus Anthracis
Class: transferase
Keywords: transferase, phosphatase, phosphorylation, sporulation, bacillus, anthracis, antithetical, negative, regulator, spine
Deposited on 2005-08-14, released 2006-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved domain protein
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81SJ3 (0-53)
    • PDB 2BZB (54-61)
    Domains in SCOPe 2.08: d2bzba1, d2bzba2
  • Chain 'B':
    Compound: conserved domain protein
    Species: BACILLUS ANTHRACIS [TaxId:198094]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81SJ3 (0-53)
    • PDB 2BZB (54-61)
    Domains in SCOPe 2.08: d2bzbb2, d2bzbb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bzbA (A:)
    memgqlknkienkkkeliqlvarhgldhdkvllfsrdldklinkfmnvkdkvhklehhhh
    hh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bzbB (B:)
    memgqlknkienkkkeliqlvarhgldhdkvllfsrdldklinkfmnvkdkvhklehhhh
    hh