PDB entry 2bz7

View 2bz7 on RCSB PDB site
Description: oxidized and reduced structures of a mutant plastocyanin of fern
Class: electron transport
Keywords: fern, electron transport, metal-binding, thylakoid, transport
Deposited on 2005-08-12, released 2006-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin
    Species: DRYOPTERIS CRASSIRHIZOMA [TaxId:97234]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SIB8 (0-101)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d2bz7a_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bz7A (A:)
    akvevgdevgnfkfypdsitvsageaveftlvgetphnivfdipagapgtvaselkaasm
    dendllsedepsfkakvstpgtytfyctphksanmkgtltvk