PDB entry 2bz0

View 2bz0 on RCSB PDB site
Description: crystal structure of e. coli GTP cyclohydrolase II in complex with GTP analogue, gmpcpp, and zinc
Class: hydrolase
Keywords: riboflavin biosynthesis, GTP cyclohydrolase II, catalytic zinc, GTP, hydrolase, magnesium
Deposited on 2005-08-09, released 2005-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP cyclohydrolase II
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bz0a1
  • Chain 'B':
    Compound: GTP cyclohydrolase II
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bz0b_
  • Heterogens: ZN, MG, G2P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bz0A (A:)
    mqlkrvaeaklptpwgdflmvgfeelatghdhvalvygdisghtpvlarvhsecltgdal
    fslrcdcgfqleaaltqiaeegrgillyhrqegrnigllnkirayalqdqgydtveanhq
    lgfaaderdftlcadmfkllgvnevrlltnnpkkveilteaginivervplivgrnpnne
    hyldtkaekmghllnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bz0A (A:)
    mqlkrvaeaklptpwgdflmvgfeelatghdhvalvygdisghtpvlarvhsecltgdal
    fslrcdcgfqleaaltqiaeegrgillyhrqegrnigllnkirayalqdqgydtvegfaa
    derdftlcadmfkllgvnevrlltnnpkkveilteaginivervplivg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bz0B (B:)
    mqlkrvaeaklptpwgdflmvgfeelatghdhvalvygdisghtpvlarvhsecltgdal
    fslrcdcgfqleaaltqiaeegrgillyhrqegrnigllnkirayalqdqgydtveanhq
    lgfaaderdftlcadmfkllgvnevrlltnnpkkveilteaginivervplivgrnpnne
    hyldtkaekmghllnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bz0B (B:)
    mqlkrvaeaklptpwgdflmvgfeelatghdhvalvygdisghtpvlarvhsecltgdal
    fslrcdcgfqleaaltqiaeegrgillyhrqegrnigllnkirayalqdqgydtveanhq
    lgfaaderdftlcadmfkllgvnevrlltnnpkkveilteaginivervplivg