PDB entry 2byz

View 2byz on RCSB PDB site
Description: structure of e. coli kas I h298q mutant in complex with c12 fatty acid
Class: transferase
Keywords: acyltransferase, claisen condensation, complete proteome, fatty acid biosynthesis, fatty acid synthase, thiolase fold, transferase
Deposited on 2005-08-09, released 2006-02-01
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.189
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYZ
      • engineered mutation (309)
    • Uniprot P14926 (12-417)
    Domains in SCOP 1.75: d2byza1, d2byza2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYZ
      • engineered mutation (309)
    • Uniprot P14926 (12-417)
    Domains in SCOP 1.75: d2byzb1, d2byzb2
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYZ
      • engineered mutation (309)
    • Uniprot P14926 (12-417)
    Domains in SCOP 1.75: d2byzc1, d2byzc2
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYZ
      • engineered mutation (309)
    • Uniprot P14926 (12-417)
    Domains in SCOP 1.75: d2byzd1, d2byzd2
  • Heterogens: NH4, DAO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2byzA (A:)
    mrgshhhhhhgsmkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnsqgtstpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2byzA (A:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsqgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2byzB (B:)
    mrgshhhhhhgsmkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnsqgtstpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2byzB (B:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsqgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2byzC (C:)
    mrgshhhhhhgsmkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnsqgtstpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2byzC (C:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsqgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2byzD (D:)
    mrgshhhhhhgsmkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnsqgtstpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2byzD (D:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsqgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd