PDB entry 2byy

View 2byy on RCSB PDB site
Description: E.coli KAS I H298E Mutation
Class: transferase
Keywords: transferase, acyltransferase, claisen condensation, fatty acid biosynthesis, fatty acid synthase, thiolase fold
Deposited on 2005-08-09, released 2006-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYY
      • engineered mutation (309)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d2byya1, d2byya2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYY
      • engineered mutation (309)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d2byyb1, d2byyb2
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYY
      • engineered mutation (309)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d2byyc1, d2byyc2
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYY
      • engineered mutation (309)
    • Uniprot P14926 (12-417)
    Domains in SCOPe 2.07: d2byyd1, d2byyd2
  • Heterogens: NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2byyA (A:)
    mrgshhhhhhgsmkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnsegtstpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2byyA (A:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsegt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2byyB (B:)
    mrgshhhhhhgsmkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnsegtstpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2byyB (B:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsegt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2byyC (C:)
    mrgshhhhhhgsmkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnsegtstpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2byyC (C:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsegt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2byyD (D:)
    mrgshhhhhhgsmkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnsegtstpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2byyD (D:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnsegt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd