PDB entry 2byw

View 2byw on RCSB PDB site
Description: structure of escherichia coli beta-ketoacyl (acyl carrier protein) synthase I lys328ala mutant
Class: transferase
Keywords: condensing enzyme, fatty acid biosynthesis, kas I, transferase, acyltransferase, lipid synthesis
Deposited on 2005-08-09, released 2005-09-09
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOP 1.75: d2bywa1, d2bywa2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOP 1.75: d2bywb1, d2bywb2
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOP 1.75: d2bywc1, d2bywc2
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase I
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A953
      • engineered mutation (15)
      • engineered mutation (339)
    • Uniprot P14926 (12-417)
    Domains in SCOP 1.75: d2bywd1, d2bywd2
  • Heterogens: NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bywA (A:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bywA (A:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bywB (B:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bywB (B:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bywC (C:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bywC (C:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bywD (D:)
    mrgshhhhhhgsmkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshv
    wgnvkldttglidrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsggg
    sprfqvfgadamrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsah
    cignaveqiqlgkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdg
    fviaggggmvvveelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgv
    dtpidylnshgtstpvgdvkelaairevfgdkspaisataamtghslgaagvqeaiysll
    mlehgfiapsinieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bywD (D:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisataamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd