PDB entry 2byh

View 2byh on RCSB PDB site
Description: 3-(5-chloro-2,4-dihydroxyphenyl)-pyrazole-4-carboxamides as inhibitors of the hsp90 molecular chaperone
Class: chaperone
Keywords: pyrazole, hsp90, chaperone, ATP-binding, heat shock, nucleotide-binding, phosphorylation
Deposited on 2005-08-02, released 2005-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock protein hsp90-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYH
      • conflict (61)
    • Uniprot P07900 (9-End)
    Domains in SCOPe 2.08: d2byha_
  • Heterogens: 2D7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2byhA (A:)
    peetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiry
    esltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmea
    lqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmg
    rgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2byhA (A:)
    pmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskl
    dsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadism
    igqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhl
    kedqteyleerrikeivkkhsqfigypitlfveke