PDB entry 2byg

View 2byg on RCSB PDB site
Description: 2nd pdz domain of discs large homologue 2
Class: signal transduction
Keywords: dlg2, pdz, pdz domain, structural genomics, structural genomics consortium, sgc, phosphorylation, sh3 domain, signal transduction
Deposited on 2005-08-01, released 2005-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.2
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: channel associated protein of synapse-110
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BYG (Start-22)
      • conflict see remark 9 (111)
    • Uniprot Q15700 (23-116)
    Domains in SCOPe 2.08: d2byga1, d2byga2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2bygA (A:)
mhhhhhhssgvdlgtenlyfqsmtvveiklfkgpkglgfsiaggvgnqhipgdnsiyvtk
iidggaaqkdgrlqvgdrllmvnnysleevtheeavailkntsevvylkvgkpttiy

    Sequence, based on observed residues (ATOM records): (download) 
    >2bygA (A:)
fqsmtvveiklfkgpkglgfsiaggvgnqhipgdnsiyvtkiidggaaqkdgrlqvgdrl
lmvnnysleevtheeavailkntsevvylkvgkpttiy