PDB entry 2byf

View 2byf on RCSB PDB site
Description: nmr solution structure of phospholipase c epsilon ra 2 domain
Class: lipase
Keywords: phospholipase c epsilon, ras binding domain, ubiquitin superfold, lipase
Deposited on 2005-08-01, released 2006-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase c, epsilon 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VWL5 (0-115)
      • engineered mutation (19)
    Domains in SCOPe 2.07: d2byfa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2byfA (A:)
    sseeesffvqvhdvspeqpltvikaprvstaqdviqqtlckakysysilsnpnpsdyvll
    eevvkdttnkktttpkssqrvlldqecvfqaqskwkgagkfilklkeqvqasredk