PDB entry 2byc

View 2byc on RCSB PDB site
Description: blrb - a bluf protein, dark state structure
Class: signaling protein
Keywords: signaling protein, photoreceptor, flavin
Deposited on 2005-07-29, released 2005-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.234
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: blue-light receptor of the bluf-family
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3IYE4
      • expression tag (0)
      • conflict (133)
    Domains in SCOPe 2.08: d2byca1, d2byca2
  • Chain 'B':
    Compound: blue-light receptor of the bluf-family
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3IYE4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d2bycb2, d2bycb3
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bycA (A:)
    fmdelvsltyrsrvrladpvadivqimrasrvrnlrlgitgillyngvhfvqtiegprsa
    cdelfrlisadprhqeilafdlepitarrfpdwsmrivsrkelralapdlerldlsgped
    vaelhrtiaaslsrgda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bycB (B:)
    fmdelvsltyrsrvrladpvadivqimrasrvrnlrlgitgillyngvhfvqtiegprsa
    cdelfrlisadprhqeilafdlepitarrfpdwsmrivsrkelralapdlerldlsgped
    vaelhrtiaaslsrgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bycB (B:)
    fmdelvsltyrsrvrladpvadivqimrasrvrnlrlgitgillyngvhfvqtiegprsa
    cdelfrlisadprhqeilafdlepitarrfpdwsmrivsrkelralapdlerldlsgped
    vaelhrtiaasl