PDB entry 2bya

View 2bya on RCSB PDB site
Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Class: hydrolase
Keywords: data collection, radiation damage, dose-rate, synchrotron radiation, hydrolase
Deposited on 2005-07-29, released 2006-02-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.109
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2byax_
  • Heterogens: BAM, GOL, SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2byaX (X:)
    fiflallgaavafpvddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaah
    cyksgiqvrlgedninvvegneqfisasksivhpsynsntlnndimliklksaaslnsrv
    asislptscasagtqclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnm
    fcagyleggkdscqgdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqti
    asn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2byaX (X:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn