PDB entry 2by7

View 2by7 on RCSB PDB site
Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Class: hydrolase
Keywords: data collection,radiation damage,dose-rate,synchrotron radiation,hydrolase
Deposited on 2005-07-29, released 2006-02-06
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-06, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.10602
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: cationic trypsin
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2by7x1
  • Heterogens: SO4, CA, BAM, GOL, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2by7X (X:)
    fiflallgaavafpvddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaah
    cyksgiqvrlgedninvvegneqfisasksivhpsynsntlnndimliklksaaslnsrv
    asislptscasagtqclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnm
    fcagyleggkdscqgdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqti
    asn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2by7X (X:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn