PDB entry 2by1

View 2by1 on RCSB PDB site
Description: is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Class: hydrolase
Keywords: data collection, radiation damage, dose-rate, synchrotron radiation, hydrolase
Deposited on 2005-07-28, released 2006-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.159
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltooligosyltrehalose trehalohydrolase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RX51 (432-601)
    • PDB 2BY1 (430-431)
    Domains in SCOPe 2.07: d2by1a1, d2by1a2, d2by1a3
  • Heterogens: TRS, TRE, GLC, BME, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2by1A (A:)
    mtqtqpvtptppasfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmt
    slgggiyelelpvgpgarylfvldgvptpdpyarflpdgvhgeaevvdfgtfdwtdadwh
    gikladcvfyevhvgtftpegtyraaaeklpylkelgvtaiqvmplaafdgqrgwgydga
    afyapyapygrpedlmalvdaahrlglgvfldvvynhfgpsgnylssyapsyftdrfssa
    wgmgldyaephmrryvtgnarmwlrdyhfdglrldatpymtddsethiltelaqeihelg
    gthlllaedhrnlpdlvtvnhldgiwtddfhhetrvtltgeqegyyagyrggaealayti
    rrgwryegqfwavkgeeherghpsdaleapnfvyciqnhdqignrplgerlhqsdgvtlh
    eyrgaaallltlpmtpllfqgqewaastpfqffsdhagelgqavsegrkkefggfsgfsg
    edvpdpqaeqtflnsklnwaereggehartlrlyrdllrlrredpvlhnrqrenlttghd
    gdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegredltlgageavl
    vg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2by1A (A:)
    sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
    gpgarylfvldgvptpdpyarflpdgvhgeaevvdfgtfdwtdadwhgikladcvfyevh
    vgtftpegtyraaaeklpylkelgvtaiqvmplaafdgqrgwgydgaafyapyapygrpe
    dlmalvdaahrlglgvfldvvynhfgpsgnylssyapsyftdrfssawgmgldyaephmr
    ryvtgnarmwlrdyhfdglrldatpymtddsethiltelaqeihelggthlllaedhrnl
    pdlvtvnhldgiwtddfhhetrvtltgeqegyyagyrggaealaytirrgwryegqfwav
    kgeeherghpsdaleapnfvyciqnhdqignrplgerlhqsdgvtlheyrgaaallltlp
    mtpllfqgqewaastpfqffsdhagelgqavsegrkkefdvpdpqaeqtflnsklnwaer
    eggehartlrlyrdllrlrredpvlhnrqrenlttghdgdvlwvrtvtgagervllwnlg
    qdtravaevklpftvprrlllhtegredltlgageavlvg