PDB entry 2bxx

View 2bxx on RCSB PDB site
Description: Crystal structure of the N-terminal domain of IBV coronavirus nucleocapsid. Native crystal form
Class: nucleocapsid protein
Keywords: nucleocapsid protein, phosphorylation, RNA-binding, viral nucleoprotein
Deposited on 2005-07-28, released 2005-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid protein
    Species: AVIAN INFECTIOUS BRONCHITIS VIRUS [TaxId:11120]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BXX (0-1)
      • engineered mutation (58)
    • Uniprot P69597 (2-133)
    Domains in SCOPe 2.07: d2bxxa1
  • Chain 'B':
    Compound: nucleocapsid protein
    Species: AVIAN INFECTIOUS BRONCHITIS VIRUS [TaxId:11120]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BXX (0-1)
      • engineered mutation (58)
    • Uniprot P69597 (2-133)
    Domains in SCOPe 2.07: d2bxxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bxxA (A:)
    hmssgnaswfqaikakklntpppkfegsgvpdnenikpsqqhgywrrqarfkpgkggrcp
    vpdawyfyytgtgpaadlnwgdtqdgivwvaakgadtksrsnqgtrdpdkfdqyplrfsd
    ggpdgnfrwdfipl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bxxB (B:)
    hmssgnaswfqaikakklntpppkfegsgvpdnenikpsqqhgywrrqarfkpgkggrcp
    vpdawyfyytgtgpaadlnwgdtqdgivwvaakgadtksrsnqgtrdpdkfdqyplrfsd
    ggpdgnfrwdfipl