PDB entry 2bxq

View 2bxq on RCSB PDB site
Description: human serum albumin complexed with myristate, phenylbutazone and indomethacin
Class: transport protein
Keywords: transport protein, albumin, carrier protein, lipid-binding, metal-binding, drug- binding, myristate, phenylbutazone, indomethacin
Deposited on 2005-07-26, released 2005-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02768
      • conflict (520)
    Domains in SCOPe 2.07: d2bxqa1, d2bxqa2, d2bxqa3
  • Heterogens: MYR, IMN, P1Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bxqA (A:)
    dahksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesae
    ncdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpev
    dvmctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllp
    kldelrdegkassakqrlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltk
    vhtecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempa
    dlpslaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekc
    caaadphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvst
    ptlvevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkcctes
    lvnrrpcfsalevdetyvpkefnaetftfhadictlsekeeqikkqtalvelvkhkpkat
    keqlkavmddfaafvekcckaddketcfaeegkklvaasqaalgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bxqA (A:)
    hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
    dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
    mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
    delrdegkassakqrlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvh
    tecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempadl
    pslaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekcca
    aadphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvstpt
    lvevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkccteslv
    nrrpcfsalevdetyvpkefnaetftfhadictlsekeeqikkqtalvelvkhkpkatke
    qlkavmddfaafvekcckaddketcfaeegkklvaasqaalg