PDB entry 2bx7

View 2bx7 on RCSB PDB site
Description: crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,5-dihydroxybenzoate
Class: oxidoreductase
Keywords: nucleotide metabolism, dihydroorotate dehydrogenase
Deposited on 2005-07-25, released 2006-08-29
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.18669
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase
    Species: LACTOCOCCUS LACTIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bx7a1
  • Chain 'B':
    Compound: dihydroorotate dehydrogenase
    Species: LACTOCOCCUS LACTIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bx7b1
  • Heterogens: ACT, MG, FMN, 34D, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bx7A (A:)
    mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
    lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
    sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
    lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
    peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
    iadfhgklksl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bx7B (B:)
    mlnttfanakfanpfmnasgvhcmtiedleelkasqagayitksstlekregnplpryvd
    lelgsinsmglpnlgfdyyldyvlknqkenaqegpiffsiagmsaaeniamlkkiqesdf
    sgitelnlscpnvpgkpqlaydfeatekllkevftfftkplgvklppyfdlvhfdimaei
    lnqfpltyvnsvnsignglfidpeaesvvikpkdgfggiggayikptalanvrafytrlk
    peiqiigtggietgqdafehllcgatmlqigtalhkegpaifdriikeleeimnqkgyqs
    iadfhgklksl