PDB entry 2bwq

View 2bwq on RCSB PDB site
Description: Crystal Structure of the RIM2 C2A-domain at 1.4 angstrom Resolution
Class: transport protein
Keywords: c2 domain, neurotransmitter release, transport protein
Deposited on 2005-07-15, released 2005-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulating synaptic membrane exocytosis protein 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bwqa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bwqA (A:)
    qflsgqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkrrtk
    tvkktlepkwnqtfiyspvhrrefrermleitlwdqarvreeeseflgeilieletalld
    dephwyklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwqA (A:)
    qflsgqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkrrtk
    tvkktlepkwnqtfiyspvhrrefrermleitlwdqseflgeilieletallddephwyk
    lq