PDB entry 2bwp

View 2bwp on RCSB PDB site
Description: 5-aminolevulinate synthase from rhodobacter capsulatus in complex with glycine
Class: transferase
Keywords: tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal phosphate dependent, transferase, acyltransferase
Deposited on 2005-07-15, released 2005-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.169
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-aminolevulinate synthase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18079 (0-End)
      • variant (101)
      • variant (104)
      • variant (116)
      • variant (127)
      • variant (204)
      • variant (261)
    Domains in SCOPe 2.08: d2bwpa_
  • Chain 'B':
    Compound: 5-aminolevulinate synthase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18079 (0-End)
      • variant (101)
      • variant (104)
      • variant (116)
      • variant (127)
      • variant (204)
      • variant (261)
    Domains in SCOPe 2.08: d2bwpb_
  • Chain 'D':
    Compound: 5-aminolevulinate synthase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18079 (0-End)
      • variant (101)
      • variant (104)
      • variant (116)
      • variant (127)
      • variant (204)
      • variant (261)
    Domains in SCOPe 2.08: d2bwpd_
  • Chain 'E':
    Compound: 5-aminolevulinate synthase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18079 (0-End)
      • variant (101)
      • variant (104)
      • variant (116)
      • variant (127)
      • variant (204)
      • variant (261)
    Domains in SCOPe 2.08: d2bwpe_
  • Heterogens: PLG, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bwpA (A:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwarca
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwpA (A:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bwpB (B:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwarca
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwpB (B:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bwpD (D:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwarca
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwpD (D:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bwpE (E:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwarca
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwpE (E:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwa