PDB entry 2bwo

View 2bwo on RCSB PDB site
Description: 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa
Class: transferase
Keywords: tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal phosphate dependent, transferase, acyltransferase
Deposited on 2005-07-15, released 2005-09-27
The last revision prior to the SCOP 1.73 freeze date was dated 2005-09-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.16303
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-aminolevulinate synthase
    Species: Rhodobacter capsulatus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18079 (0-End)
      • variant (101)
      • variant (104)
      • variant (116)
      • variant (127)
      • variant (204)
      • variant (261)
    Domains in SCOP 1.73: d2bwoa1
  • Chain 'B':
    Compound: 5-aminolevulinate synthase
    Species: Rhodobacter capsulatus
    Domains in SCOP 1.73: d2bwob1
  • Chain 'D':
    Compound: 5-aminolevulinate synthase
    Species: Rhodobacter capsulatus
    Domains in SCOP 1.73: d2bwod1
  • Chain 'E':
    Compound: 5-aminolevulinate synthase
    Species: Rhodobacter capsulatus
    Domains in SCOP 1.73: d2bwoe1
  • Heterogens: SCA, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bwoA (A:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwarca
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwoA (A:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bwoB (B:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwarca
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwoB (B:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bwoD (D:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwarca
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwoD (D:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bwoE (E:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwarca
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwoE (E:)
    mdynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwcgndylgmg
    qhpvvlaamhealeavgagsggtrnisgttayhrrleaeiaglhqkeaalvfssaynand
    atlstlrvlfpgliiysdslnhasmiegikrnagpkrifrhndvahlreliaaddpaapk
    liafesvysmdgdfgpikeicdiaeefgaltyidevhavgmygprgagvaerdglmhrid
    ifngtlakaygvfggyiaasarmvdavrsyapgfifstslppaiaagaqasiaflktaeg
    qklrdaqqmhakvlkmrlkalgmpiidhgshivpvvigdpvhtkavsdmllsdygvyvqp
    infptvprgterlrftpspvhdlkqidglvhamdllwar