PDB entry 2bwk

View 2bwk on RCSB PDB site
Description: murine angiogenin, sulphate complex
Class: hydrolase
Keywords: ribonuclease, angiogenesis, cancer, hydrolase
Deposited on 2005-07-15, released 2005-11-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.179
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bwka_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bwkA (A:)
    qddsrytkfltqhhdakpkgrddrycermmkrrsltspckdvntfihgnksnikaicgan
    gspyrenlrmskspfqvttckhtggsprppcqyrasagfrhvviacenglpvhfdesffs
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwkA (A:)
    dsrytkfltqhhdakpkgrddrycermmkrrsltspckdvntfihgnksnikaicgangs
    pyrenlrmskspfqvttckhtggsprppcqyrasagfrhvviacenglpvhfdesffs