PDB entry 2bwh

View 2bwh on RCSB PDB site
Description: laue structure of a short lived state of l29w myoglobin
Class: oxygen transport
Keywords: laue crystallography, l29w myoglobin, time-resolved x-ray structure determination, oxygen transport
Deposited on 2005-07-14, released 2005-07-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2299
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon, synthetic [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (28)
    Domains in SCOPe 2.05: d2bwha1
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bwhA (A:)
    vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gnfgadaqgamnkalelfrkdiaakykelgyqg