PDB entry 2bwh

View 2bwh on RCSB PDB site
Description: Laue Structure of a Short Lived State of L29W Myoglobin
Class: oxygen transport
Keywords: laue crystallography, l29w myoglobin, time-resolved x-ray structure determination, oxygen transport
Deposited on 2005-07-14, released 2005-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
    • conflict (28)
    • conflict (121)
  Domains in SCOPe 2.08: d2bwha1
• Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bwhA (A:)
  vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gnfgadaqgamnkalelfrkdiaakykelgyqg