PDB entry 2bwf

View 2bwf on RCSB PDB site
Description: crystal sturcture of the ubl domain of dsk2 from s. cerevisiae
Class: signaling protein
Keywords: ubiquitin, uba, signaling proteins
Deposited on 2005-07-13, released 2006-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-25, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.18459
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin-like protein dsk2
  Species: Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • PDB 2BWF (0-1)
  • Uniprot P48510 (2-76)
  Domains in SCOP 1.73: d2bwfa1
• Chain 'B':
  Compound: ubiquitin-like protein dsk2
  Species: Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • PDB 2BWF (0-1)
  • Uniprot P48510 (2-76)
  Domains in SCOP 1.73: d2bwfb1
• Heterogens: FMT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bwfA (A:)
  ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
  syhiqdghsvhlvksqp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bwfB (B:)
  ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
  syhiqdghsvhlvksqp