PDB entry 2bwe

View 2bwe on RCSB PDB site
Description: the crystal structure of the complex between the uba and ubl domains of dsk2
Class: signaling protein
Keywords: ubiquitin, ubiquitin-like proteins, protein/protein interaction, signaling protein
Deposited on 2005-07-13, released 2006-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-25, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.24069
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwea1
  • Chain 'B':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bweb1
  • Chain 'C':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwec1
  • Chain 'D':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwed1
  • Chain 'E':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwee1
  • Chain 'F':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwef1
  • Chain 'G':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bweg1
  • Chain 'H':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bweh1
  • Chain 'I':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwei1
  • Chain 'J':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwej1
  • Chain 'K':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwek1
  • Chain 'L':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwel1
  • Chain 'M':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwem1
  • Chain 'N':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwen1
  • Chain 'O':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bweo1
  • Chain 'P':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwep1
  • Chain 'Q':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bweq1
  • Chain 'R':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwer1
  • Chain 'S':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Domains in SCOP 1.73: d2bwes1
  • Chain 'T':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Domains in SCOP 1.73: d2bwet1
  • Chain 'U':
    Compound: dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Domains in SCOP 1.73: d2bweu1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bweA (A:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweA (A:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bweB (B:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweB (B:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bweC (C:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweC (C:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bweD (D:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweD (D:)
    ildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bweE (E:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweE (E:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bweF (F:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweF (F:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bweG (G:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweG (G:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bweH (H:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweH (H:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bweI (I:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweI (I:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bweJ (J:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweJ (J:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2bweK (K:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweK (K:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2bweL (L:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweL (L:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2bweM (M:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweM (M:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2bweN (N:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweN (N:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2bweO (O:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweO (O:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2bweP (P:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweP (P:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2bweQ (Q:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweQ (Q:)
    ildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2bweR (R:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweR (R:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2bweS (S:)
    ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
    syhiqdghsvhlvksqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweS (S:)
    slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh
    iqdghsvhlvksq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2bweT (T:)
    ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
    syhiqdghsvhlvksqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweT (T:)
    slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh
    iqdghsvhlvksq
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2bweU (U:)
    ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
    syhiqdghsvhlvksqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweU (U:)
    lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi
    qdghsvhlvksq