PDB entry 2bwe

View 2bwe on RCSB PDB site
Description: The crystal structure of the complex between the UBA and UBL domains of Dsk2
Class: signaling protein
Keywords: ubiquitin, ubiquitin-like proteins, protein/protein interaction, signaling protein
Deposited on 2005-07-13, released 2006-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwea1
  • Chain 'B':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (0-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bweb_
  • Chain 'C':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-49)
    Domains in SCOPe 2.06: d2bwec_
  • Chain 'D':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwed_
  • Chain 'E':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwee_
  • Chain 'F':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwef_
  • Chain 'G':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bweg_
  • Chain 'H':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bweh_
  • Chain 'I':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwei_
  • Chain 'J':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwej_
  • Chain 'K':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwek_
  • Chain 'L':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwel_
  • Chain 'M':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwem_
  • Chain 'N':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwen_
  • Chain 'O':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bweo_
  • Chain 'P':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwep_
  • Chain 'Q':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bweq_
  • Chain 'R':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BWE (Start-3)
    • Uniprot P48510 (4-End)
    Domains in SCOPe 2.06: d2bwer_
  • Chain 'S':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bwes1
  • Chain 'T':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bwet_
  • Chain 'U':
    Compound: dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bweu_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bweA (A:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweA (A:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bweB (B:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweB (B:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bweC (C:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweC (C:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bweD (D:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweD (D:)
    ildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bweE (E:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweE (E:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bweF (F:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweF (F:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bweG (G:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweG (G:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bweH (H:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweH (H:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bweI (I:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweI (I:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bweJ (J:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweJ (J:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2bweK (K:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweK (K:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2bweL (L:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweL (L:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2bweM (M:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweM (M:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2bweN (N:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweN (N:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2bweO (O:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweO (O:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2bweP (P:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweP (P:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2bweQ (Q:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweQ (Q:)
    ildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2bweR (R:)
    gildpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllngdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweR (R:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2bweS (S:)
    ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
    syhiqdghsvhlvksqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweS (S:)
    slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh
    iqdghsvhlvksq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2bweT (T:)
    ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
    syhiqdghsvhlvksqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweT (T:)
    slnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyh
    iqdghsvhlvksq
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2bweU (U:)
    ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
    syhiqdghsvhlvksqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bweU (U:)
    lnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtvesyhi
    qdghsvhlvksq