PDB entry 2bwc

View 2bwc on RCSB PDB site
Description: structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose (5 minute soak)
Class: hydrolase
Keywords: endoglucanase, cellulase, glycoside hydrolase family 12, cellopentaose, hydrolase
Deposited on 2005-07-13, released 2005-12-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.1839
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Rhodothermus marinus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwca1
  • Chain 'B':
    Compound: endoglucanase
    Species: Rhodothermus marinus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwcb1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bwcA (A:)
    mtvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaayp
    aiyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngys
    ggaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldl
    kafiddavargyirpewylhavetgfelweggaglrsadfsvtvqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwcA (A:)
    tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
    iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
    gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
    afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bwcB (B:)
    mtvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaayp
    aiyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngys
    ggaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldl
    kafiddavargyirpewylhavetgfelweggaglrsadfsvtvqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwcB (B:)
    tvelcgrwdardvaggryrvinnvwgaetaqcievgletgnftitradhdngnnvaaypa
    iyfgchwgactsnsglprrvqelsdvrtswtltpittgrwnaaydiwfspvtnsgngysg
    gaelmiwlnwnggvmpggsrvatvelagatwevwyadwdwnyiayrrttpttsvseldlk
    afiddavargyirpewylhavetgfelweggaglrsadfsvtvqkl