PDB entry 2bwb

View 2bwb on RCSB PDB site
Description: crystal structure of the uba domain of dsk2 from s. cerevisiae
Class: signaling protein
Keywords: ubiquitin, uba, signaling protein
Deposited on 2005-07-13, released 2006-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-25, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.24595
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwba1
  • Chain 'B':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwbb1
  • Chain 'C':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwbc1
  • Chain 'D':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwbd1
  • Chain 'E':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwbe1
  • Chain 'F':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwbf1
  • Chain 'G':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwbg1
  • Chain 'H':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwbh1
  • Chain 'I':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bwbi1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bwbA (A:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bwbB (B:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbB (B:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bwbC (C:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bwbD (D:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbD (D:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bwbE (E:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbE (E:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bwbF (F:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbF (F:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bwbG (G:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbG (G:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bwbH (H:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbH (H:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bwbI (I:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbI (I:)
    dpeeryehqlrqlnfdfdrnvaalrrsggsvqgaldslln