PDB entry 2bw9

View 2bw9 on RCSB PDB site
Description: laue structure of l29w mbco
Class: oxygen transport
Keywords: oxygen transport, myoglobin mutant l29w, l29w mbco, laue crystallography,
Deposited on 2005-07-13, released 2005-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.2156
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (28)
    Domains in SCOPe 2.06: d2bw9m_
  • Heterogens: HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bw9M (M:)
    vlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gnfgadaqgamnkalelfrkdiaakykelgyqg