PDB entry 2bw6

View 2bw6 on RCSB PDB site
Description: the structure of sars 3c like protease at 1.9a
Class: hydrolase
Keywords: sars, 3c like protease, hydrolase
Deposited on 2005-07-12, released 2005-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.257
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain-like proteinase
    Species: HUMAN CORONAVIRUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bw6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bw6A (A:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
    sgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw6A (A:)
    gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk
    snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs
    psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf
    ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep
    ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs
    g