PDB entry 2bw5

View 2bw5 on RCSB PDB site
Description: atomic resolution structure of no-bound achromobacter cycloclastes cu nitrite reductase
Class: oxidoreductase
Keywords: denitrification,catalysis,enzyme mechanism,oxidoreductase, nitrate assimilation
Deposited on 2005-07-12, released 2005-08-17
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: 0.129
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bw5a1, d2bw5a2
  • Heterogens: CU, ACT, PO4, NO, MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bw5A (A:)
    aagaapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteih
    amtfngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeet
    tlrfkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvge
    qdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavger
    vlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgv
    yayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw5A (A:)
    vdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfng
    svpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfka
    tkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvp
    kdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhs
    qanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnh
    nlieafelgaaghfkvtgewnddlmtsvvkpasm