PDB entry 2bw1

View 2bw1 on RCSB PDB site
Description: iron-bound crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis.
Class: peroxide resistance
Keywords: dpr, peroxide resistance, iron-binding, ferroxidase, dps-family, ferritin-like
Deposited on 2005-07-07, released 2006-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.188
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1a_
  • Chain 'B':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1b_
  • Chain 'C':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1c_
  • Chain 'D':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1d_
  • Chain 'E':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1e_
  • Chain 'F':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1f_
  • Chain 'G':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F5J9 (0-164)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d2bw1g_
  • Chain 'H':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1h_
  • Chain 'I':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1i_
  • Chain 'J':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1j_
  • Chain 'K':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1k_
  • Chain 'L':
    Compound: dps-like peroxide resistance protein
    Species: STREPTOCOCCUS SUIS [TaxId:1307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bw1l_
  • Heterogens: EPE, FE, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bw1A (A:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1A (A:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bw1B (B:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1B (B:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bw1C (C:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1C (C:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bw1D (D:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1D (D:)
    sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
    itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
    dsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bw1E (E:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1E (E:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bw1F (F:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1F (F:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bw1G (G:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bw1H (H:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1H (H:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bw1I (I:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1I (I:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bw1J (J:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1J (J:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2bw1K (K:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1K (K:)
    psladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemser
    litlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdee
    gdsvtndifnvakasiekhiwmlqaelgqapkl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2bw1L (L:)
    gspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
    eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
    lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw1L (L:)
    ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
    tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
    svtndifnvakasiekhiwmlqaelgqapkl