PDB entry 2bw0

View 2bw0 on RCSB PDB site
Description: crystal structure of the hydrolase domain of human 10-formyltetrahydrofolate 2 dehydrogenase
Class: oxidoreductase
Keywords: dehydrogenase, nucleotide biosynthesis, oxidoreductase
Deposited on 2005-07-07, released 2005-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 10-formyltetrahydrofolate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BW0 (Start-21)
    • Uniprot O75891 (22-328)
    Domains in SCOPe 2.08: d2bw0a1, d2bw0a2, d2bw0a3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bw0A (A:)
    mhhhhhhssgvdlgtenlyfqsmkiavigqslfgqevychlrkeghevvgvftvpdkdgk
    adplgleaekdgvpvfkysrwrakgqalpdvvakyqalgaelnvlpfcsqfipmeiisap
    rhgsiiyhpsllprhrgasainwtlihgdkkggfsifwaddgldtgdlllqkecevlpdd
    tvstlynrflfpegikgmvqavrliaegkaprlpqpeegatyegiqkketakinwdqpae
    aihnwirgndkvpgawteaceqkltffnstlntsglvpegdalpipgahrpgvvtkagli
    lfgnddkmllvkniqledgkmilasnffk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bw0A (A:)
    qsmkiavigqslfgqevychlrkeghevvgvftvpdkdgkadplgleaekdgvpvfkysr
    wrakgqalpdvvakyqalgaelnvlpfcsqfipmeiisaprhgsiiyhpsllprhrgasa
    inwtlihgdkkggfsifwaddgldtgdlllqkecevlpddtvstlynrflfpegikgmvq
    avrliaegkaprlpqpeegatyegiqkketakinwdqpaeaihnwirgndkvpgawteac
    eqkltffnstlntsglvpegdalpipgahrpgvvtkaglilfgnddkmllvkniqledgk
    milasnffk