PDB entry 2bvy

View 2bvy on RCSB PDB site
Description: the structure and characterization of a modular endo-beta-1,4-mannanase from cellulomonas fimi
Class: hydrolase
Keywords: glycoside hydrolase,beta-1,4-mannanase,family 26, clan gh-a, cellulomonas fimi
Deposited on 2005-07-04, released 2005-09-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-09-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.193
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-1,4-mannanase
    Species: Cellulomonas fimi
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bvya1, d2bvya2
  • Heterogens: CAC, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bvyA (A:)
    madetiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvt
    gdfpavfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtg
    gsfydtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagsw
    fwwgaaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafv
    dvlgldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwf
    tkvlaaikadpvasrnaymetwanfdagqhfvpvpgdalledfqayaadpftlfasevtg
    afdrtvaaapaqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtld
    laydgalwwtapwsptsaqldnstytvtatattaagtldvtnevaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bvyA (A:)
    tiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvtgdfp
    avfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtggsfy
    dtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagswfwwg
    aaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafvdvlg
    ldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwftkvl
    aaikadpvasrnaymetwanfdagqhfvpvpgdalledfqayaadpftlfasevtgafdr
    tvaaapaqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqvvdtldlaydgal
    wwtapwspytvtatattaagtldvtnevaaal