PDB entry 2bvw

View 2bvw on RCSB PDB site
Description: cellobiohydrolase ii (cel6a) from humicola insolens in complex with glucose and cellotetraose
Deposited on 1999-02-18, released 2000-02-25
The last revision prior to the SCOP 1.57 freeze date was dated 2000-02-25, with a file datestamp of 2000-02-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d2bvwa_
  • Chain 'B':
    Domains in SCOP 1.57: d2bvwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bvwA (A:)
    ngnpfegvqlwannyyrsevhtlaipqitdpalraaasavaevpsfqwldrnvtvdtllv
    qtlseireanqaganpqyaaqivvydlpdrdcaaaasngewaianngvnnykayinrire
    ilisfsdvrtilviepdslanmvtnmnvpkcsgaastyreltiyalkqldlphvamymda
    ghagwlgwpaniqpaaelfakiyedagkpravrglatnvanynawsvsspppytspnpny
    dekhyieafrplleargfpaqfivdqgrsgkqptgqkewghwcnaigtgfgmrptantgh
    qyvdafvwvkpggecdgtsdttaarydyhcgledalkpapeagqwfneyfiqllrnanpp
    f
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bvwB (B:)
    gnpfegvqlwannyyrsevhtlaipqitdpalraaasavaevpsfqwldrnvtvdtllvq
    tlseireanqaganpqyaaqivvydlpdrdcaaaasngewaianngvnnykayinrirei
    lisfsdvrtilviepdslanmvtnmnvpkcsgaastyreltiyalkqldlphvamymdag
    hagwlgwpaniqpaaelfakiyedagkpravrglatnvanynawsvsspppytspnpnyd
    ekhyieafrplleargfpaqfivdqgrsgkqptgqkewghwcnaigtgfgmrptantghq
    yvdafvwvkpggecdgtsdttaarydyhcgledalkpapeagqwfneyfiqllrnanppf