PDB entry 2bvv

View 2bvv on RCSB PDB site
Description: sugar ring distortion in the glycosyl-enzyme intermediate of a family g/11 xylanase.
Class: hydrolase
Keywords: xylanase, glycosidase, hydrolase
Deposited on 1998-11-17, released 1999-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.188
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (endo-1,4-beta-xylanase)
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09850 (0-184)
      • engineered (68)
    Domains in SCOPe 2.08: d2bvva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bvvA (A:)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlfgwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
    nvtvw