PDB entry 2bvn

View 2bvn on RCSB PDB site
Description: e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia
Class: elongation factor
Keywords: translation, elongation factor, gtpase, antibiotic, GTP-binding, phosphorylation
Deposited on 2005-06-30, released 2005-09-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bvna1, d2bvna2, d2bvna3
  • Chain 'B':
    Compound: elongation factor tu
    Species: ESCHERICHIA COLI [TaxId:511693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bvnb1, d2bvnb2, d2bvnb3
  • Heterogens: GNP, MG, ENX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bvnA (A:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bvnA (A:)
    kphvnvgtighvdhgkttltaaittvlaktyggekargitintshveydtptrhyahvdc
    pghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvd
    deellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipe
    peraidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemf
    rklldegragenvgvllrgikreeiergqvlakpgtikphtkfesevyilskdeggrhtp
    ffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfaireggr
    tvgagvvakvls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bvnB (B:)
    skekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
    tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
    lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
    daeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvge
    eveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikp
    htkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvv
    tlihpiamddglrfaireggrtvgagvvakvls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bvnB (B:)
    ertkphvnvgtighvdhgkttltaaittvlaktygargitintshveydtptrhyahvdc
    pghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvd
    deellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipe
    peraidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemf
    rklldegragenvgvllrgikreeiergqvlakpgtikphtkfesevyilskdeggrhtp
    ffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfaireggr
    tvgagvvakvls