PDB entry 2bvi

View 2bvi on RCSB PDB site
Description: The quasi-atomic model of Human Adenovirus type 5 capsid (Part 1)
Class: virus
Keywords: virus, adenovirus, minor capsid protein, quasi atomic
Deposited on 2005-06-28, released 2006-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: 10 Å
R-factor: N/A
AEROSPACI score: -0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvif1, d2bvif2
  • Chain 'G':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvig1, d2bvig2
  • Chain 'H':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvih1, d2bvih2
  • Chain 'I':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvii1, d2bvii2
  • Chain 'J':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvij1, d2bvij2
  • Chain 'K':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvik1, d2bvik2
  • Chain 'L':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvil1, d2bvil2
  • Chain 'M':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvim1, d2bvim2
  • Chain 'N':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvin1, d2bvin2
  • Chain 'O':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvio1, d2bvio2
  • Chain 'P':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bvip1, d2bvip2
  • Chain 'Q':
    Compound: hexon protein
    Species: HUMAN ADENOVIRUS TYPE 5 [TaxId:28285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bviq1, d2bviq2

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bviF (F:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviF (F:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bviG (G:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviG (G:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bviH (H:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviH (H:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bviI (I:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviI (I:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bviJ (J:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviJ (J:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2bviK (K:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviK (K:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2bviL (L:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviL (L:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2bviM (M:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviM (M:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2bviN (N:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviN (N:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2bviO (O:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviO (O:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2bviP (P:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviP (P:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2bviQ (Q:)
    atpsmmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrs
    qrltlrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtay
    nalapkgapnpcewdeaataleinleeedddnedevdeqaeqqkthvfgqapysginitk
    egiqigvegqtpkyadktfqpepqigesqwyeteinhaagrvlkkttpmkpcygsyakpt
    nenggqgilvkqqngklesqvemqffstteatagngdnltpkvvlysedvdietpdthis
    ymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasqlnavvdl
    qdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycfplggvi
    ntetltkvkpktgqengwekdatefsdkneirvgnnfameinlnanlwrnflysnialyl
    pdklkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrna
    glryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndl
    rvdgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanat
    nvpisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkv
    aitfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgf
    yipesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqa
    ypanfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahal
    dmtfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsagnatt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bviQ (Q:)
    mmpqwsymhisgqdaseylspglvqfaratetyfslnnkfrnptvapthdvttdrsqrlt
    lrfipvdredtaysykarftlavgdnrvldmastyfdirgvldrgptfkpysgtaynala
    pkgapnpcewdthvfgqapysginitkegiqigkyadktfqpepqigesqwyeteinhaa
    grvlkkttpmkpcygsyakptnenggqgilvesqvemqffsttnltpkvvlysedvdiet
    pdthisymptikegnsrelmgqqsmpnrpnyiafrdnfiglmyynstgnmgvlagqasql
    navvdlqdrntelsyqllldsigdrtryfsmwnqavdsydpdvriienhgtedelpnycf
    plggvintetltkvkpgwekdafsdkneirvgnnfameinlnanlwrnflysnialylpd
    klkyspsnvkisdnpntydymnkrvvapglvdcyinlgarwsldymdnvnpfnhhrnagl
    ryrsmllgngryvpfhiqvpqkffaiknllllpgsytyewnfrkdvnmvlqsslgndlrv
    dgasikfdsiclyatffpmahntastleamlrndtndqsfndylsaanmlypipanatnv
    pisipsrnwaafrgwaftrlktketpslgsgydpyytysgsipyldgtfylnhtfkkvai
    tfdssvswpgndrlltpnefeikrsvdgegynvaqcnmtkdwflvqmlanynigyqgfyi
    pesykdrmysffrnfqpmsrqvvddtkykdyqqvgilhqhnnsgfvgylaptmregqayp
    anfpypligktavdsitqkkflcdrtlwripfssnfmsmgaltdlgqnllyansahaldm
    tfevdpmdeptllyvlfevfdvvrvhrphrgvietvylrtpfsa