PDB entry 2bv9

View 2bv9 on RCSB PDB site
Description: how family 26 glycoside hydrolases orchestrate catalysis on different polysaccharides. structure and activity of a clostridium thermocellum lichenase, ctlic26a
Class: hydrolase
Keywords: hydrolase, beta-1 4 beta-1 3 glucanase, glycoside hydrolase family 26
Deposited on 2005-06-23, released 2005-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.132
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase h
    Species: CLOSTRIDIUM THERMOCELLUM [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16218 (Start-281)
      • expression tag (282-289)
    Domains in SCOPe 2.07: d2bv9a1, d2bv9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bv9A (A:)
    masnynsglkigawvgtqpsesaiksfqelqgrkldivhqfinwstdfswvrpyadavyn
    ngsilmitwepweyntvdikngkadayitrmaqdmkaygkeiwlrplheangdwypwaig
    yssrvntnetyiaafrhivdifrangatnvkwvfnvncdnvgngtsylghypgdnyvdyt
    sidgynwgttqswgsqwqsfdqvfsrayqalasinkpiiiaefasaeiggnkarwiteay
    nsirtsynkviaavwfhenketdwrinsspealaayreaigalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bv9A (A:)
    sglkigawvgtqpsesaiksfqelqgrkldivhqfinwstdfswvrpyadavynngsilm
    itwepweyntvdikngkadayitrmaqdmkaygkeiwlrplheangdwypwaigyssrvn
    tnetyiaafrhivdifrangatnvkwvfnvncdnvgngtsylghypgdnyvdytsidgyn
    wgttqswgsqwqsfdqvfsrayqalasinkpiiiaefasaeiggnkarwiteaynsirts
    ynkviaavwfhenketdwrinsspealaayreaigalehhhhhh