PDB entry 2bv7

View 2bv7 on RCSB PDB site
Description: crystal structure of gltp with bound gm3
Class: lipid transport
Keywords: glycolipid, ligand binding, acetylation, lipid transport, repeat, transport, glycolipid transfer protein
Deposited on 2005-06-23, released 2005-12-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bv7a_
  • Heterogens: SO4, GM3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bv7A (A:)
    allaehllrplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavyd
    tnptkfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhp
    nlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekvr
    lflvnytatidviyemytrmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bv7A (A:)
    llrplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnptkf
    rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
    atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekvrlflvny
    tatidviyemytrmnaelnykv