PDB entry 2bv3

View 2bv3 on RCSB PDB site
Description: crystal structure of a mutant elongation factor g trapped with a GTP analogue
Class: elongation factor
Keywords: switch II, elongation factor, GTP-binding, translation mutation thr84ala, protein biosynthesis
Deposited on 2005-06-22, released 2005-08-10
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13551
      • engineered mutation (83)
      • conflict (434)
      • conflict (438)
      • conflict (447)
      • conflict (457)
    Domains in SCOP 1.75: d2bv3a1, d2bv3a2, d2bv3a3, d2bv3a4, d2bv3a5
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bv3A (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidapghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeesptfsvsthpetgstiisgmgelsleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bv3A (A:)
    ydlkrlrnigiaahidagktttterilyytgrihkrgititaavttcfwkdhriniidap
    ghvdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgad
    lwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeey
    ldqareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalk
    nkgvqllldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrl
    tfirvysgtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketit
    gdtlvgedaprvilesievpepvidvaiepsptfsvsthpetgstiisgmgelsleiivv
    gkpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipk
    eyipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqk
    gdpvilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgya
    tdlrsktqgrgsfvmffdhyqevpkqvqekli