PDB entry 2bv1

View 2bv1 on RCSB PDB site
Description: regulator of g-protein signalling 1 (human)
Class: signaling protein
Keywords: rgs1, rgs, g-protein, regulator, structural genomics, structural genomics consortium, b-cell activation, phosphorylation, signal transduction inhibitor, signaling protein
Deposited on 2005-06-20, released 2005-06-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulator of g-protein signalling 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bv1a_
  • Chain 'B':
    Compound: regulator of g-protein signalling 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bv1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bv1A (A:)
    smsgmksskskdvlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlaced
    ykktesdllpckaeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviyt
    lmekdsyprflksdiylnllndlqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bv1A (A:)
    kdvlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlacedykktesdllp
    ckaeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviytlmekdsyprf
    lksdiylnllndlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bv1B (B:)
    smsgmksskskdvlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlaced
    ykktesdllpckaeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviyt
    lmekdsyprflksdiylnllndlqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bv1B (B:)
    dvlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlacedykktesdllpc
    kaeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviytlmekdsyprfl
    ksdiylnlln