PDB entry 2buw

View 2buw on RCSB PDB site
Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r457s in complex with 4-hydroxybenzoate
Class: oxidoreductase
Keywords: dioxygenase, aromatic degradation, non-heme iron, beta-sandwich, mixed alpha/beta structure, oxidoreductase
Deposited on 2005-06-20, released 2006-10-26
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-26, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.165
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: Acinetobacter calcoaceticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2buwa1
  • Chain 'B':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: Acinetobacter calcoaceticus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20372 (Start-240)
      • engineered mutation (157)
    Domains in SCOP 1.75: d2buwb1
  • Heterogens: FE, PHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2buwA (A:)
    mngwnfqelketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvf
    dglglplrdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikp
    gavpgrkgstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlv
    akreerdgevvyrfdiriqgenetvffdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2buwA (A:)
    elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
    rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
    gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
    gevvyrfdiriqgenetvffdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2buwB (B:)
    msqiiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpk
    dndlilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigam
    dpnfggcgrmltddngyyvfrtikpgpypwrnrinewspahihfsliadgwaqrlisqfy
    fegdtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendl
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2buwB (B:)
    iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
    lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
    fggcgrmltddngyyvfrtikpgpypwrnrinewspahihfsliadgwaqrlisqfyfeg
    dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt