PDB entry 2buu

View 2buu on RCSB PDB site
Description: Crystal Structure Of Protocatechuate 3,4-Dioxygenase from Acinetobacter Sp. ADP1 Mutant R457S in complex with 4-Nitrocatechol
Class: oxidoreductase
Keywords: dioxygenase, aromatic degradation, non-heme iron, beta-sandwich, mixed alpha/beta structure, oxidoreductase
Deposited on 2005-06-17, released 2006-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: ACINETOBACTER CALCOACETICUS [TaxId:62977]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2buua_
  • Chain 'B':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: ACINETOBACTER CALCOACETICUS [TaxId:62977]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20372 (Start-240)
      • engineered mutation (157)
    Domains in SCOPe 2.08: d2buub_
  • Heterogens: FE, 4NC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2buuA (A:)
    mngwnfqelketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvf
    dglglplrdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikp
    gavpgrkgstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlv
    akreerdgevvyrfdiriqgenetvffdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2buuA (A:)
    elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
    rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
    gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
    gevvyrfdiriqgenetvffdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2buuB (B:)
    msqiiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpk
    dndlilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigam
    dpnfggcgrmltddngyyvfrtikpgpypwrnrinewspahihfsliadgwaqrlisqfy
    fegdtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendl
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2buuB (B:)
    iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
    lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
    fggcgrmltddngyyvfrtikpgpypwrnrinewspahihfsliadgwaqrlisqfyfeg
    dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt