PDB entry 2bur

View 2bur on RCSB PDB site
Description: crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 in complex with 4-hydroxybenzoate
Class: oxidoreductase
Keywords: oxidoreductase, dioxygenase, aromatic degradation, non-heme iron, beta- sandwich, mixed alpha/beta structure
Deposited on 2005-06-17, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.163
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protocatechuate 3,4-dioxygenase alpha chain
    Species: ACINETOBACTER CALCOACETICUS [TaxId:62977]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bura_
  • Chain 'B':
    Compound: protocatechuate 3,4-dioxygenase beta chain
    Species: ACINETOBACTER CALCOACETICUS [TaxId:62977]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2burb_
  • Heterogens: FE, PHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2burA (A:)
    mngwnfqelketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvf
    dglglplrdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikp
    gavpgrkgstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlv
    akreerdgevvyrfdiriqgenetvffdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2burA (A:)
    elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
    rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
    gstqaphisliifarginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
    gevvyrfdiriqgenetvffdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2burB (B:)
    msqiiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpk
    dndlilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigam
    dpnfggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfy
    fegdtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendl
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2burB (B:)
    iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
    lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
    fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
    dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt